SAE1 (NM_005500) Human Recombinant Protein
CAT＃: TP301820
Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg
View other "SAE1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201820 protein sequence
Red=Cloning site Green=Tags(s) MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38.3 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | ELISA capture for autoantibodies (PMID: 28298642) |
| Reference Data | |
| RefSeq | NP_005491 |
| Locus ID | 10055 |
| UniProt ID | Q9UBE0 |
| Refseq Size | 2538 |
| Cytogenetics | 19q13.32 |
| Refseq ORF | 1038 |
| Synonyms | AOS1; HSPC140; SUA1; UBLE1A |
| Summary | Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Clinical characteristics of anti-SAE antibodies in Chinese patients with dermatomyositis in comparison with different patient cohorts
,Ge, Y;Lu, X;Shu, X;Peng, Q;Wang, G;,
Sci Rep
,PubMed ID 28298642
[SAE1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401688 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428977 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429497 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401688 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
CNY 3080.00 |
|
| LY428977 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2 |
CNY 3080.00 |
|
| LY429497 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
CNY 3080.00 |
|
| PH301820 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_005491) |
CNY 19520.00 |
|
| PH326908 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001139185) |
CNY 14250.00 |
|
| PH327950 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_057486) |
CNY 19520.00 |
|
| TP326908 | Purified recombinant protein of Homo sapiens SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP327950 | Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg |
CNY 2900.00 |
