SNX1 (NM_003099) Human Recombinant Protein
CAT#: TP301844
Recombinant protein of human sorting nexin 1 (SNX1), transcript variant 1, 20 µg
View other "SNX1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201844 protein sequence
Red=Cloning site Green=Tags(s) MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPINN GSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQE DQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPP PPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLS GAGLLKMFNKATDAVSKMTIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKS LAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW QDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIRFEKEKSKDFK NHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 58.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003090 |
| Locus ID | 6642 |
| UniProt ID | Q13596 |
| Refseq Size | 8332 |
| Cytogenetics | 15q22.31 |
| Refseq ORF | 1566 |
| Synonyms | HsT17379; VPS5 |
| Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. This protein also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members. This gene results in three transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407727 | SNX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC418900 | SNX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407727 | Transient overexpression lysate of sorting nexin 1 (SNX1), transcript variant 2 |
CNY 4840.00 |
|
| LY418900 | Transient overexpression lysate of sorting nexin 1 (SNX1), transcript variant 1 |
CNY 3080.00 |
|
| PH301844 | SNX1 MS Standard C13 and N15-labeled recombinant protein (NP_003090) |
CNY 19520.00 |
