UAP56 (DDX39B) (NM_080598) Human Recombinant Protein
CAT#: TP301847
Recombinant protein of human HLA-B associated transcript 1 (BAT1), transcript variant 2, 20 µg
View other "UAP56" proteins (7)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC201847 protein sequence 
Red=Cloning site Green=Tags(s) MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSE VQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYM PNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRD VQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFD LLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRG MDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDI SSYIEQTR myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 48.8 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_542165 | 
| Locus ID | 7919 | 
| UniProt ID | Q13838 | 
| Refseq Size | 2044 | 
| Cytogenetics | 6p21.33 | 
| Refseq ORF | 1284 | 
| Synonyms | BAT1; D6S81E; UAP56 | 
| Summary | This gene encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and it also plays an important role in mRNA export from the nucleus to the cytoplasm. This gene belongs to a cluster of genes localized in the vicinity of the genes encoding tumor necrosis factor alpha and tumor necrosis factor beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on both chromosomes 6 and 11. Read-through transcription also occurs between this gene and the upstream ATP6V1G2 (ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2) gene. [provided by RefSeq, Feb 2011] | 
| Protein Pathways | Spliceosome | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401471 | DDX39B HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC409144 | DDX39B HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401471 | Transient overexpression lysate of HLA-B associated transcript 1 (BAT1), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY409144 | Transient overexpression lysate of HLA-B associated transcript 1 (BAT1), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| PH301248 | BAT1 MS Standard C13 and N15-labeled recombinant protein (NP_004631) | 
                                                     CNY 19520.00  | 
                                            |
| PH301847 | BAT1 MS Standard C13 and N15-labeled recombinant protein (NP_542165) | 
                                                     CNY 19520.00  | 
                                            |
| TP301248 | Recombinant protein of human HLA-B associated transcript 1 (BAT1), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
