PGRMC1 (NM_006667) Human Recombinant Protein
CAT#: TP301918
Recombinant protein of human progesterone receptor membrane component 1 (PGRMC1), 20 µg
View other "PGRMC1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC201918 protein sequence 
Red=Cloning site Green=Tags(s) MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 21.5 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_006658 | 
| Locus ID | 10857 | 
| UniProt ID | O00264 | 
| Refseq Size | 1931 | 
| Cytogenetics | Xq24 | 
| Refseq ORF | 585 | 
| Synonyms | Dap1; HPR6.6; IZA; MPR | 
| Summary | This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010] | 
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transmembrane | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401994 | PGRMC1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401994 | Transient overexpression lysate of progesterone receptor membrane component 1 (PGRMC1) | 
                                                     CNY 3080.00  | 
                                            |
| PH301918 | PGRMC1 MS Standard C13 and N15-labeled recombinant protein (NP_006658) | 
                                                     CNY 14250.00  | 
                                            
