RAB23 (NM_016277) Human Recombinant Protein
CAT#: TP301922
Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 1, 20 µg
View other "RAB23" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201922 protein sequence
Red=Cloning site Green=Tags(s) MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEE FDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALA KRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLN GGDVINLRPNKQRTKKNRNPFSSCSIP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057361 |
| Locus ID | 51715 |
| UniProt ID | Q9ULC3 |
| Refseq Size | 4837 |
| Cytogenetics | 6p12.1-p11.2 |
| Refseq ORF | 711 |
| Synonyms | HSPC137 |
| Summary | This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome |
| Protein Pathways | Hedgehog signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402532 | RAB23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405187 | RAB23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402532 | Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 1 |
CNY 3080.00 |
|
| LY405187 | Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 2 |
CNY 3080.00 |
|
| PH301922 | RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_057361) |
CNY 19520.00 |
|
| PH321508 | RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_899050) |
CNY 19520.00 |
|
| TP321508 | Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 2, 20 µg |
CNY 2900.00 |
