TBCE (NM_003193) Human Recombinant Protein
CAT#: TP301927
Recombinant protein of human tubulin folding cofactor E (TBCE), transcript variant 2, 20 µg
View other "TBCE" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201927 protein sequence
Red=Cloning site Green=Tags(s) MSDTLTADVIGRRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFKCRHPTGGSFI RPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDSIMKQQSQLSKLQEVSLRNCAVS CAGEKGGVAEACPNIRKVDLSKNLLSSWDEVIHIADQLRHLEVLNVSENKLKFPSGSVLTGTLSVLKVLV LNQTGITWAEVLRCVAGCPGLEELYLESNNIFISERPTDVLQTVKLLDLSSNQLIDENQLYLIAHLPRLE QLILSDTGISSLHFPDAGIGCKTSMFPSLKYLVVNDNQISQWSFFNELEKLPSLRALSCLRNPLTKEDKE AETARLLIIASIGQLKTLNKCEILPEERRRAELDYRKAFGNEWKQAGGHKDPEKNRLSEEFLTAHPRYQF LCLKYGAPEDWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLL LSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003184 |
| Locus ID | 6905 |
| UniProt ID | Q15813 |
| Refseq Size | 1977 |
| Cytogenetics | 1q42.3 |
| Refseq ORF | 1581 |
| Synonyms | HRD; KCS; KCS1; pac2; PEAMO |
| Summary | Cofactor E is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418845 | TBCE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421507 | TBCE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY418845 | Transient overexpression lysate of tubulin folding cofactor E (TBCE), transcript variant 2 |
CNY 3080.00 |
|
| LY421507 | Transient overexpression lysate of tubulin folding cofactor E (TBCE), transcript variant 1 |
CNY 4840.00 |
|
| PH301927 | TBCE MS Standard C13 and N15-labeled recombinant protein (NP_003184) |
CNY 19520.00 |
|
| PH314027 | TBCE MS Standard C13 and N15-labeled recombinant protein (NP_001072983) |
CNY 19520.00 |
|
| TP314027 | Recombinant protein of human tubulin folding cofactor E (TBCE), transcript variant 1, 20 µg |
CNY 2900.00 |
