LYPLA2 (NM_007260) Human Recombinant Protein
CAT#: TP302021
Recombinant protein of human lysophospholipase II (LYPLA2), 20 µg
View other "LYPLA2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202021 protein sequence
Red=Cloning site Green=Tags(s) MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLA GIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMH SSCPQEMAAVKEFLEKLLPPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_009191 |
| Locus ID | 11313 |
| UniProt ID | O95372 |
| Refseq Size | 1648 |
| Cytogenetics | 1p36.11 |
| Refseq ORF | 693 |
| Synonyms | APT-2; APT2; DJ886K2.4 |
| Summary | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Glycerophospholipid metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416098 | LYPLA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416098 | Transient overexpression lysate of lysophospholipase II (LYPLA2) |
CNY 3080.00 |
|
| PH302021 | LYPLA2 MS Standard C13 and N15-labeled recombinant protein (NP_009191) |
CNY 19520.00 |
|
| TP720900 | Purified recombinant protein of Human lysophospholipase II (LYPLA2) |
CNY 1800.00 |
