EZH2 (NM_004456) Human Recombinant Protein
CAT#: TP302054
Recombinant protein of human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1, 20 µg
View other "EZH2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 4 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202054 protein sequence
Red=Cloning site Green=Tags(s) MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHI LTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLD QDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDK ESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHS FHTLFCRRCFKYDCFLHRKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKT PPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQ TPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDV DTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQN RFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWG IFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNC YAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 85.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | EMSA assay (PMID: 26173710) Binding assay (AlphaScreen) (PMID: 26173710) In vitro ubiquitination assay substrate (PMID: 27869166) |
Reference Data | |
RefSeq | NP_004447 |
Locus ID | 2146 |
UniProt ID | Q15910 |
Refseq Size | 2723 |
Cytogenetics | 7q36.1 |
Refseq ORF | 2253 |
Synonyms | ENX-1; ENX1; EZH2b; KMT6; KMT6A; WVS; WVS2 |
Summary | This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Citations (4)
The use of this Proteins has been cited in the following citations: |
---|
A PRC2-independent function for EZH2 in regulating rRNA 2′-O methylation and IRES-dependent translation
,null,
Nature cell biology
,PubMed ID 33795875
[EZH2]
|
SKP2 loss destabilizes EZH2 by promoting TRAF6-mediated ubiquitination to suppress prostate cancer
,Lu, W;Liu, S;Li, B;Xie, Y;Izban, MG;Ballard, BR;Sathyanarayana, SA;Adunyah, SE;Matusik, RJ;Chen, Z;,
Oncogene
,PubMed ID 27869166
[EZH2]
|
Antisense RNA-Mediated Epigenetic Regulation of Brain-Derived Neurotrophic Factor
,Pedram Fatemi, R;,
Thesis Dec2015
[EZH2]
|
Screening for Small-Molecule Modulators of Long Noncoding RNA-Protein Interactions Using AlphaScreen
,Pedram Fatemi, R;Salah-Uddin, S;Modarresi, F;Khoury, N;Wahlestedt, C;Faghihi, MA;,
J Biomol Screen
,PubMed ID 26173710
[EZH2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401416 | EZH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407239 | EZH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC430254 | EZH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY401416 | Transient overexpression lysate of enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1 |
CNY 3080.00 |
|
LY407239 | Transient overexpression lysate of enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 2 |
CNY 4840.00 |
|
LY430254 | Transient overexpression lysate of enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 2 |
CNY 4840.00 |
|
PH302054 | EZH2 MS Standard C13 and N15-labeled recombinant protein (NP_004447) |
CNY 19520.00 |