G0S2 (NM_015714) Human Recombinant Protein
CAT#: TP302063
Recombinant protein of human G0/G1switch 2 (G0S2), 20 µg
View other "G0S2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202063 protein sequence
Red=Cloning site Green=Tags(s) METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAAL ERQALQKQALQEKGKQQDTVLGGRALSNRQHAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 11.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Enzyme activity regulator (PMID: 27408777) |
| Reference Data | |
| RefSeq | NP_056529 |
| Locus ID | 50486 |
| UniProt ID | P27469 |
| Refseq Size | 978 |
| Cytogenetics | 1q32.2 |
| Refseq ORF | 309 |
| Summary | Promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
G0/G1 Switch Gene 2 controls adipose triglyceride lipase activity and lipid metabolism in skeletal muscle
,Laurens, C;Badin, PM;Louche, K;Mairal, A;,
Molecular Metabolism
,PubMed ID 27408777
[G0S2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
