IL8 (CXCL8) (NM_000584) Human Recombinant Protein
CAT#: TP302075
Recombinant protein of human interleukin 8 (IL8), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 2600.00
CNY 3600.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202075 representing NM_000584
Red=Cloning site Green=Tags(s) MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKL SDGRELCLDPKENWVQRVVEKFLKRAENS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000575 |
Locus ID | 3576 |
UniProt ID | P10145 |
Refseq Size | 1666 |
Cytogenetics | 4q13.3 |
Refseq ORF | 297 |
Synonyms | GCP-1; GCP1; IL8; LECT; LUCT; LYNAP; MDNCF; MONAP; NAF; NAP-1; NAP1; SCYB8 |
Summary | The protein encoded by this gene is a member of the CXC chemokine family and is a major mediator of the inflammatory response. The encoded protein is commonly referred to as interleukin-8 (IL-8). IL-8 is secreted by mononuclear macrophages, neutrophils, eosinophils, T lymphocytes, epithelial cells, and fibroblasts. It functions as a chemotactic factor by guiding the neutrophils to the site of infection. Bacterial and viral products rapidly induce IL-8 expression. IL-8 also participates with other cytokines in the proinflammatory signaling cascade and plays a role in systemic inflammatory response syndrome (SIRS). This gene is believed to play a role in the pathogenesis of the lower respiratory tract infection bronchiolitis, a common respiratory tract disease caused by the respiratory syncytial virus (RSV). The overproduction of this proinflammatory protein is thought to cause the lung inflammation associated with csytic fibrosis. This proinflammatory protein is also suspected of playing a role in coronary artery disease and endothelial dysfunction. This protein is also secreted by tumor cells and promotes tumor migration, invasion, angiogenesis and metastasis. This chemokine is also a potent angiogenic factor. The binding of IL-8 to one of its receptors (IL-8RB/CXCR2) increases the permeability of blood vessels and increasing levels of IL-8 are positively correlated with increased severity of multiple disease outcomes (eg, sepsis). This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q. [provided by RefSeq, May 2020] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Bladder cancer, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway, Pathways in cancer, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400198 | CXCL8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400198 | Transient overexpression lysate of interleukin 8 (IL8) |
CNY 3080.00 |
|
PH302075 | IL8 MS Standard C13 and N15-labeled recombinant protein (NP_000575) |
CNY 19520.00 |
|
TP701252 | Purified recombinant protein of Human interleukin 8 (IL8), expressed in HEK293 cells, full length, with C-terminal His tag, secretory expressed in HEK293 cells, 100ug |
CNY 7820.00 |
|
TP720027 | Recombinant protein of human interleukin 8 (IL8) |
CNY 1800.00 |
|
TP720029 | Recombinant protein of human interleukin 8 (IL8) |
CNY 1800.00 |
|
TP721122 | Purified recombinant protein of Human interleukin 8 (IL8) |
CNY 1800.00 |
|
TP723733 | Purified recombinant protein of Human interleukin 8 (IL8) |
CNY 4090.00 |