SEC11C (NM_033280) Human Recombinant Protein
CAT#: TP302122
Recombinant protein of human SEC11 homolog C (S. cerevisiae) (SEC11C), 20 µg
View other "SEC11C" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202122 protein sequence
Red=Cloning site Green=Tags(s) MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSME PAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKE GQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_150596 |
Locus ID | 90701 |
UniProt ID | Q9BY50 |
Refseq Size | 793 |
Cytogenetics | 18q21.32 |
Refseq ORF | 576 |
Synonyms | SEC11L3; SPC21; SPCS4C |
Summary | Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function] |
Protein Families | Protease, Transmembrane |
Protein Pathways | Protein export |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403241 | SEC11C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403241 | Transient overexpression lysate of SEC11 homolog C (S. cerevisiae) (SEC11C) |
CNY 3080.00 |
|
PH302122 | SEC11C MS Standard C13 and N15-labeled recombinant protein (NP_150596) |
CNY 19520.00 |