Membrin (GOSR2) (NM_004287) Human Recombinant Protein
CAT#: TP302175
Recombinant protein of human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A, 20 µg
View other "Membrin" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202175 protein sequence
Red=Cloning site Green=Tags(s) MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRV DQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDL ILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQY LT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004278 |
| Locus ID | 9570 |
| UniProt ID | O14653 |
| Refseq Size | 3319 |
| Cytogenetics | 17q21.32 |
| Refseq ORF | 636 |
| Synonyms | Bos1; EPM6; GS27 |
| Summary | This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409306 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418077 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422877 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409306 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant B |
CNY 3080.00 |
|
| LY418077 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant A |
CNY 3080.00 |
|
| LY422877 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant C |
CNY 3080.00 |
|
| PH302175 | GOSR2 MS Standard C13 and N15-labeled recombinant protein (NP_004278) |
CNY 19520.00 |
其它Membrin产品
