IKB beta (NFKBIB) (NM_002503) Human Recombinant Protein
CAT#: TP302182
Recombinant protein of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta (NFKBIB), transcript variant 1, 20 µg
View other "IKB beta" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202182 protein sequence
Red=Cloning site Green=Tags(s) MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDTALHLAVIHQH EPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAH ACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEAENYEGHTP LHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGS AMLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLP DDPRPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002494 |
Locus ID | 4793 |
UniProt ID | Q15653 |
Refseq Size | 1243 |
Cytogenetics | 19q13.2 |
Refseq ORF | 1068 |
Synonyms | IKBB; TRIP9 |
Summary | The protein encoded by this gene belongs to the NF-kappa-B inhibitor family, which inhibit NF-kappa-B by complexing with, and trapping it in the cytoplasm. Phosphorylation of serine residues on these proteins by kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B, which translocates to the nucleus to function as a transcription factor. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jul 2011] |
Protein Families | Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Adipocytokine signaling pathway, B cell receptor signaling pathway, Chemokine signaling pathway, Cytosolic DNA-sensing pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419285 | NFKBIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424220 | NFKBIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425058 | NFKBIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419285 | Transient overexpression lysate of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta (NFKBIB), transcript variant 1 |
CNY 3080.00 |
|
LY424220 | Transient overexpression lysate of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta (NFKBIB), transcript variant 2 |
CNY 3080.00 |
|
PH302182 | NFKBIB MS Standard C13 and N15-labeled recombinant protein (NP_002494) |
CNY 19520.00 |
|
PH318695 | NFKBIB MS Standard C13 and N15-labeled recombinant protein (NP_001001716) |
CNY 14250.00 |
|
TP318695 | Purified recombinant protein of Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta (NFKBIB), transcript variant 2, 20 µg |
CNY 2900.00 |
其它IKB beta产品