TRAPPC4 (NM_016146) Human Recombinant Protein
CAT#: TP302213
Recombinant protein of human trafficking protein particle complex 4 (TRAPPC4), 20 µg
View other "TRAPPC4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202213 protein sequence
Red=Cloning site Green=Tags(s) MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMD VNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETD TFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAE KAGTFGPGS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057230 |
| Locus ID | 51399 |
| UniProt ID | Q9Y296 |
| Refseq Size | 1216 |
| Cytogenetics | 11q23.3 |
| Refseq ORF | 657 |
| Synonyms | CGI-104; HSPC172; NEDESBA; PTD009; SBDN; SYNBINDIN; TRS23 |
| Summary | May play a role in vesicular transport from endoplasmic reticulum to Golgi.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414159 | TRAPPC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414159 | Transient overexpression lysate of trafficking protein particle complex 4 (TRAPPC4) |
CNY 3080.00 |
|
| PH302213 | TRAPPC4 MS Standard C13 and N15-labeled recombinant protein (NP_057230) |
CNY 19520.00 |
其它TRAPPC4产品
