EMP3 (NM_001425) Human Recombinant Protein
CAT#: TP302216
Recombinant protein of human epithelial membrane protein 3 (EMP3), 20 µg
View other "EMP3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202216 protein sequence
Red=Cloning site Green=Tags(s) MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLM VLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFA LAWVAFPLALVSGIIYIHLRKRE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001416 |
Locus ID | 2014 |
UniProt ID | P54852 |
Refseq Size | 850 |
Cytogenetics | 19q13.33 |
Refseq ORF | 489 |
Synonyms | YMP |
Summary | The protein encoded by this gene belongs to the PMP-22/EMP/MP20 family of proteins. The protein contains four transmembrane domains and two N-linked glycosylation sites. It is thought to be involved in cell proliferation, cell-cell interactions and function as a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400554 | EMP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400554 | Transient overexpression lysate of epithelial membrane protein 3 (EMP3) |
CNY 3080.00 |
|
PH302216 | EMP3 MS Standard C13 and N15-labeled recombinant protein (NP_001416) |
CNY 19520.00 |