Apoptosis enhancing nuclease (AEN) (NM_022767) Human Recombinant Protein
CAT#: TP302285M
Recombinant protein of human apoptosis enhancing nuclease (AEN), 100 µg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 9998.00
CNY 6281.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC202285 protein sequence 
Red=Cloning site Green=Tags(s) MVPREAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGA ATATEAASSGKQCLRAGSGSAPCSRRPAPGKASGPLPSKCVAIDCEMVGTGPRGRVSELARCSIVSYHGD VLYDKYIRPEMPIADYRTRWSGITRQHMRKAVPFQVAQKEILKLLKGKVVVGHALHNDFQALKYVHPRSQ TRDTTYVPNFLSEPGLHTRARVSLKDLALQLLHKKIQVGQHGHSSVEDATTAMELYRLVEVQWEQQEARS LWTCPEDREPDSSTDMEQYMEDQYWPDDLAHGSRGGAREAQDRRN myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 36.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_073604 | 
| Locus ID | 64782 | 
| UniProt ID | Q8WTP8 | 
| Refseq Size | 3134 | 
| Cytogenetics | 15q26.1 | 
| Refseq ORF | 975 | 
| Synonyms | ISG20L1; pp12744 | 
| Summary | Exonuclease with activity against single- and double-stranded DNA and RNA. Mediates p53-induced apoptosis. When induced by p53 following DNA damage, digests double-stranded DNA to form single-stranded DNA and amplifies DNA damage signals, leading to enhancement of apoptosis.[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
其它Apoptosis enhancing nuclease产品
