LRRC51 (NM_145309) Human Recombinant Protein
CAT#: TP302297
Recombinant protein of human leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1, 20 µg
View other "LRRC51" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202297 protein sequence
Red=Cloning site Green=Tags(s) MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQV ASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPME EEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660352 |
Locus ID | 220074 |
UniProt ID | Q96E66 |
Refseq Size | 2658 |
Cytogenetics | 11q13.4 |
Refseq ORF | 576 |
Summary | This locus represents naturally occurring readthrough transcription between the neighboring LRRC51 (leucine-rich repeat containing 51) and TOMT (transmembrane O-methyltransferase) genes on chromosome 11. The readthrough transcript encodes a fusion protein that shares sequence identity with each individual gene product. Multiple reports implicate mutations in this gene in nonsyndromic deafness.[provided by RefSeq, Feb 2021] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407958 | LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428810 | LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428811 | LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407958 | Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1 |
CNY 3080.00 |
|
LY428810 | Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 2 |
CNY 3080.00 |
|
LY428811 | Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 4 |
CNY 3080.00 |
|
PH302297 | LRTOMT MS Standard C13 and N15-labeled recombinant protein (NP_660352) |
CNY 19520.00 |