MED30 (NM_080651) Human Recombinant Protein
CAT#: TP302305M
Recombinant protein of human mediator complex subunit 30 (MED30), 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202305 protein sequence
Red=Cloning site Green=Tags(s) MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGT YQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERR EIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_542382 |
| Locus ID | 90390 |
| UniProt ID | Q96HR3 |
| Refseq Size | 994 |
| Cytogenetics | 8q24.11 |
| Refseq ORF | 534 |
| Synonyms | MED30S; THRAP6; TRAP25 |
| Summary | The multiprotein TRAP/Mediator complex facilitates gene expression through a wide variety of transcriptional activators. MED30 is a component of this complex that appears to be metazoan specific (Baek et al., 2002 [PubMed 11909976]).[supplied by OMIM, Nov 2010] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
