UBA5 (NM_024818) Human Recombinant Protein
CAT#: TP302327
Recombinant protein of human ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1, 20 µg
View other "UBA5" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202327 representing NM_024818
Red=Cloning site Green=Tags(s) MAESVERLQQRVQELERELAQERSLQVPRSGDGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEK IRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINP DVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSEN AVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVS FYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELVSEVS EEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079094 |
Locus ID | 79876 |
UniProt ID | Q9GZZ9 |
Refseq Size | 2720 |
Cytogenetics | 3q22.1 |
Refseq ORF | 1212 |
Synonyms | DEE44; EIEE44; SCAR24; THIFP1; UBE1DC1 |
Summary | This gene encodes a member of the E1-like ubiquitin-activating enzyme family. This protein activates ubiquitin-fold modifier 1, a ubiquitin-like post-translational modifier protein, via the formation of a high-energy thioester bond. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been identified on chromosome 1. [provided by RefSeq, Feb 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405021 | UBA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411039 | UBA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405021 | Transient overexpression lysate of ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 2 |
CNY 3080.00 |
|
LY411039 | Transient overexpression lysate of ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1 |
CNY 3080.00 |
|
PH302327 | UBA5 MS Standard C13 and N15-labeled recombinant protein (NP_079094) |
CNY 19520.00 |
|
TP721148 | Purified recombinant protein of Human ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1 |
CNY 1800.00 |