Profilin 1 (PFN1) (NM_005022) Human Recombinant Protein
CAT#: TP302338
Recombinant protein of human profilin 1 (PFN1), 20 µg
View other "Profilin 1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202338 protein sequence
Red=Cloning site Green=Tags(s) MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQK CSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Pull-down assay (PMID: 27991922) |
Reference Data | |
RefSeq | NP_005013 |
Locus ID | 5216 |
UniProt ID | P07737 |
Refseq Size | 1365 |
Cytogenetics | 17p13.2 |
Refseq ORF | 420 |
Synonyms | ALS18 |
Summary | This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Regulation of actin cytoskeleton |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Phosphoglycerate mutase 1 promotes cancer cell migration independent of its metabolic activity
,Zhang, D;Jin, N;Sun, W;Li, X;Liu, B;Xie, Z;Qu, J;Xu, J;Yang, X;Su, Y;Tang, S;Han, H;Chen, D;Ding, J;Tan, M;Huang, M;Geng, M;,
Oncogene
,PubMed ID 27991922
[PFN1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
其它Profilin 1产品