SEPTIN10 (NM_144710) Human Recombinant Protein
CAT#: TP302381
Recombinant protein of human septin 10 (SEPT10), transcript variant 1, 20 µg
View other "SEPTIN10" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202381 protein sequence
Red=Cloning site Green=Tags(s) MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVGFESLPDQLVNRSIQQGFCFNIL CVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQ PIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKA DTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGNKMVKARQY PWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEA KRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAF SKKKATSEIFHSQSFLATGSNLRKDKDRKNSNFL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 52.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_653311 |
| Locus ID | 151011 |
| UniProt ID | Q9P0V9 |
| Refseq Size | 3256 |
| Cytogenetics | 2q13 |
| Refseq ORF | 1362 |
| Synonyms | SEPT10 |
| Summary | This gene encodes a member of the septin family of cytoskeletal proteins with GTPase activity. This protein localizes to the cytoplasm and nucleus and displays GTP-binding and GTPase activity. A pseudogene for this gene is located on chromosome 8. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405865 | 42257 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC408161 | 42257 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405865 | Transient overexpression lysate of septin 10 (SEPT10), transcript variant 2 |
CNY 4840.00 |
|
| LY408161 | Transient overexpression lysate of septin 10 (SEPT10), transcript variant 1 |
CNY 3080.00 |
|
| PH302381 | SEPT10 MS Standard C13 and N15-labeled recombinant protein (NP_653311) |
CNY 19520.00 |
其它SEPTIN10产品


