IL1RA (IL1RN) (NM_173843) Human Recombinant Protein
CAT#: TP302447
Purified recombinant protein of Homo sapiens interleukin 1 receptor antagonist (IL1RN), transcript variant 4, 20 µg
View other "IL1RA" proteins (15)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC202447 protein sequence 
Red=Cloning site Green=Tags(s) MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGG KMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSL TNMPDEGVMVTKFYFQEDE myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 16 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_776215 | 
| Locus ID | 3557 | 
| UniProt ID | P18510 | 
| Refseq Size | 1973 | 
| Cytogenetics | 2q14.1 | 
| Refseq ORF | 477 | 
| Synonyms | DIRA; ICIL-1RA; IL-1ra; IL-1ra3; IL-1RN; IL1F3; IL1RA; IRAP; MVCD4 | 
| Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Aug 2020] | 
| Protein Families | Druggable Genome, Secreted Protein | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC403570 | IL1RN HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC403571 | IL1RN HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC406440 | IL1RN HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC424628 | IL1RN HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY403570 | Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY403571 | Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 4 | 
                                                     CNY 3080.00  | 
                                            |
| LY406440 | Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| LY424628 | Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 3 | 
                                                     CNY 3080.00  | 
                                            |
| PH302447 | IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776215) | 
                                                     CNY 14250.00  | 
                                            |
| PH312460 | IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_000568) | 
                                                     CNY 19520.00  | 
                                            |
| PH318518 | IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776214) | 
                                                     CNY 19520.00  | 
                                            |
| TP312460 | Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 3, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP318518 | Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP720025 | Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 3 | 
                                                     CNY 1800.00  | 
                                            |
| TP760033 | Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 
                                                     CNY 2040.00  | 
                                            
