beta Synuclein (SNCB) (NM_003085) Human Recombinant Protein
CAT#: TP302449
Recombinant protein of human synuclein, beta (SNCB), transcript variant 2, 20 µg
View other "beta Synuclein" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202449 protein sequence
Red=Cloning site Green=Tags(s) MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 14.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003076 |
| Locus ID | 6620 |
| UniProt ID | Q16143 |
| Refseq Size | 1310 |
| Cytogenetics | 5q35.2 |
| Refseq ORF | 402 |
| Summary | This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401075 | SNCB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424365 | SNCB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401075 | Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 2 |
CNY 3080.00 |
|
| LY424365 | Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 1 |
CNY 3080.00 |
|
| PH302449 | SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076) |
CNY 19520.00 |
|
| PH315165 | SNCB MS Standard C13 and N15-labeled recombinant protein (NP_001001502) |
CNY 19520.00 |
|
| TP315165 | Recombinant protein of human synuclein, beta (SNCB), transcript variant 1, 20 µg |
CNY 2900.00 |
其它beta Synuclein产品
