Chemokine Receptor D6 (ACKR2) (NM_001296) Human Recombinant Protein
CAT#: TP302459
Recombinant protein of human chemokine binding protein 2 (CCBP2), 20 µg
View other "Chemokine Receptor D6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202459 protein sequence
Red=Cloning site Green=Tags(s) MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLPVFYSLIFVLGLSGNLLLLMV LLRYVPRRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSL DKYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNCHADFGGHGTIWKLFL RFQQNLLGFLLPLLAMIFFYSRIGCVLVRLRPAGQGRALKIAAALVVAFFVLWFPYNLTLFLHTLLDLQV FGNCEVSQHLDYALQVTESIAFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSES SILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001287 |
| Locus ID | 1238 |
| UniProt ID | O00590 |
| Refseq Size | 2978 |
| Cytogenetics | 3p22.1 |
| Refseq ORF | 1152 |
| Synonyms | CCBP2; CCR9; CCR10; CMKBR9; D6; hD6 |
| Summary | This gene encodes a beta chemokine receptor, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptor-mediated signal transduction are critical for the recruitment of effector immune cells to the inflammation site. This gene is expressed in a range of tissues and hemopoietic cells. The expression of this receptor in lymphatic endothelial cells and overexpression in vascular tumors suggested its function in chemokine-driven recirculation of leukocytes and possible chemokine effects on the development and growth of vascular tumors. This receptor appears to bind the majority of beta-chemokine family members; however, its specific function remains unknown. This gene is mapped to chromosome 3p21.3, a region that includes a cluster of chemokine receptor genes. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400518 | ACKR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400518 | Transient overexpression lysate of chemokine binding protein 2 (CCBP2) |
CNY 3080.00 |
|
| PH302459 | CCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001287) |
CNY 19520.00 |
其它Chemokine Receptor D6产品
