Uteroglobin (SCGB1A1) (NM_003357) Human Recombinant Protein
CAT#: TP302497L
Recombinant protein of human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202497 protein sequence
Red=Cloning site Green=Tags(s) MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP QKPRESIIKLMEKIAQSSLCN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 9.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003348 |
| Locus ID | 7356 |
| UniProt ID | P11684 |
| Refseq Size | 452 |
| Cytogenetics | 11q12.3 |
| Refseq ORF | 273 |
| Synonyms | CC10; CC16; CCPBP; CCSP; UGB; UP-1; UP1 |
| Summary | This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defects in this gene are associated with a susceptibility to asthma. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
其它Uteroglobin产品
