TACD2 (TACSTD2) (NM_002353) Human Recombinant Protein
CAT＃: TP302519
Recombinant protein of human tumor-associated calcium signal transducer 2 (TACSTD2), 20 µg
View other "TACD2" proteins (14)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202519 protein sequence
Red=Cloning site Green=Tags(s) MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002344 |
| Locus ID | 4070 |
| UniProt ID | P09758 |
| Refseq Size | 2080 |
| Cytogenetics | 1p32.1 |
| Refseq ORF | 969 |
| Synonyms | EGP-1; EGP1; GA733-1; GA7331; GP50; M1S1; TROP2 |
| Summary | This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419381 | TACSTD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419381 | Transient overexpression lysate of tumor-associated calcium signal transducer 2 (TACSTD2) |
CNY 3080.00 |
|
| PH302519 | TACSTD2 MS Standard C13 and N15-labeled recombinant protein (NP_002344) |
CNY 19520.00 |
|
| TP721339 | Human Trop2 Protein (C-His) |
CNY 2450.00 |
|
| TP721340 | Human Trop2 Protein (C-His-Avi) |
CNY 2450.00 |
|
| TP721341 | Biotinylated Human Trop2 Protein (C-His-Avi) |
CNY 3480.00 |
|
| TP721342 | PE Conjugated Human Trop2 Protein (C-His) |
CNY 3480.00 |
|
| TP721343 | APC Conjugated Human Trop2 Protein (C-His) |
CNY 3480.00 |
|
| TP721344 | Human Trop2 Protein (C-Fc) |
CNY 2450.00 |
|
| TP721345 | Human Trop2 Protein (C-Fc-Avi) |
CNY 2450.00 |
|
| TP721346 | Biotinylated Human Trop2 Protein (C-Fc-Avi) |
CNY 3480.00 |
|
| TP721347 | PE Conjugated Human Trop2 Protein (C-Fc) |
CNY 3480.00 |
|
| TP721348 | APC Conjugated Human Trop2 Protein (C-Fc) |
CNY 3480.00 |
|
| TP724028 | Human Trop2 Protein, mFc-His Tag |
CNY 5249.00 |
