PPPDE1 (DESI2) (NM_016076) Human Recombinant Protein
CAT#: TP302524
Recombinant protein of human PPPDE peptidase domain containing 1 (PPPDE1), 20 µg
View other "PPPDE1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202524 protein sequence
Red=Cloning site Green=Tags(s) MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFK EAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPF LQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057160 |
| Locus ID | 51029 |
| UniProt ID | Q9BSY9 |
| Refseq Size | 4109 |
| Cytogenetics | 1q44 |
| Refseq ORF | 582 |
| Synonyms | C1orf121; CGI-146; DESI; DeSI-2; DESI1; FAM152A; PNAS-4; PPPDE1 |
| Summary | Has deubiquitinating activity towards 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Deubiquitinates 'Lys-48'-linked polyubiquitination of RPS7 leading to its stabilization (PubMed:28483520).[UniProtKB/Swiss-Prot Function] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
PPPDE1 is a novel deubiquitinase belonging to a cysteine isopeptidase family.
,null,
Biochemical and biophysical research communications
,PubMed ID 28483520
[DESI2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414201 | DESI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414201 | Transient overexpression lysate of PPPDE peptidase domain containing 1 (PPPDE1) |
CNY 3080.00 |
|
| PH302524 | PPPDE1 MS Standard C13 and N15-labeled recombinant protein (NP_057160) |
CNY 19520.00 |
