START domain containing 7 (STARD7) (NM_020151) Human Recombinant Protein
CAT#: TP302539
Recombinant protein of human StAR-related lipid transfer (START) domain containing 7 (STARD7), 20 µg
View other "START domain containing 7" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202539 protein sequence
Red=Cloning site Green=Tags(s) MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVM DKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHW VTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFD YLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSE RKNEGSCGPARIEYA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064536 |
Locus ID | 56910 |
UniProt ID | Q9NQZ5 |
Refseq Size | 3394 |
Cytogenetics | 2q11.2 |
Refseq ORF | 885 |
Synonyms | FAME2; GTT1 |
Summary | May play a protective role in mucosal tissues by preventing exaggerated allergic responses.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408330 | STARD7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412634 | STARD7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408330 | Transient overexpression lysate of START domain containing 7 (STARD7), transcript variant 2 |
CNY 3080.00 |
|
LY412634 | Transient overexpression lysate of StAR-related lipid transfer (START) domain containing 7 (STARD7) |
CNY 3080.00 |
|
PH302539 | STARD7 MS Standard C13 and N15-labeled recombinant protein (NP_064536) |
CNY 19520.00 |
|
PH303423 | STARD7 MS Standard C13 and N15-labeled recombinant protein (NP_644672) |
CNY 19520.00 |
|
TP303423 | Recombinant protein of human START domain containing 7 (STARD7), transcript variant 2, 20 µg |
CNY 2900.00 |
其它START domain containing 7产品