ZC4H2 (NM_018684) Human Recombinant Protein
CAT#: TP302589
Recombinant protein of human zinc finger, C4H2 domain containing (ZC4H2), 20 µg
View other "ZC4H2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202589 protein sequence
Red=Cloning site Green=Tags(s) MADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKMAHVEELRLIH ADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRLPDLCEEEEKLSLDYFEKQKA EWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFRQQPPPMKACLSCHQQIHRNAPICPLCKAKS RSRNPKKPKRKQDE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061154 |
Locus ID | 55906 |
UniProt ID | Q9NQZ6 |
Refseq Size | 2812 |
Cytogenetics | Xq11.2 |
Refseq ORF | 672 |
Synonyms | HCA127; KIAA1166; MCS; MRXS4; WRWF; WRWFFR; WWS |
Summary | This gene encodes a member of the zinc finger domain-containing protein family. This family member has a C-terminal zinc finger domain that is characterized by four cysteine residues and two histidine residues, and it also includes a coiled-coil region. This protein has been detected as an autoantigen in hepatocellular carcinoma patients. This gene has been identified as a potential candidate for X-linked cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412985 | ZC4H2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432640 | ZC4H2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412985 | Transient overexpression lysate of zinc finger, C4H2 domain containing (ZC4H2) |
CNY 3080.00 |
|
LY432640 | Transient overexpression lysate of zinc finger, C4H2 domain containing (ZC4H2), transcript variant 3 |
CNY 3080.00 |
|
PH302589 | ZC4H2 MS Standard C13 and N15-labeled recombinant protein (NP_061154) |
CNY 19520.00 |