HSPC142 (BABAM1) (NM_014173) Human Recombinant Protein
CAT#: TP302644
Recombinant protein of human chromosome 19 open reading frame 62 (C19orf62), transcript variant 2, 20 µg
View other "HSPC142" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202644 protein sequence
Red=Cloning site Green=Tags(s) MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGP KSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDK SHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYV VRTILVYSRPPCQPQFSLTEPMKKMFQCPYFFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKY EVALAGPALELHNCMAKLLAHPLQRPCQSHASYSLLEEEDEAIEVEATV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_054892 |
| Locus ID | 29086 |
| UniProt ID | Q9NWV8 |
| Refseq Size | 1467 |
| Cytogenetics | 19p13.11 |
| Refseq ORF | 987 |
| Synonyms | C19orf62; HSPC142; MERIT40; NBA1 |
| Summary | Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it is required for the complex integrity and its localization at DSBs. Component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates (PubMed:24075985, PubMed:26195665). In these 2 complexes, it is probably required to maintain the stability of BABAM2 and help the 'Lys-63'-linked deubiquitinase activity mediated by BRCC3/BRCC36 component. The BRISC complex is required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating NUMA1 (PubMed:26195665). Plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor IFNAR1; deubiquitination increases IFNAR1 activity by enhancing its stability and cell surface expression (PubMed:24075985). Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in IFNAR1 deubiquitination (PubMed:24075985).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415463 | BABAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422382 | BABAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415463 | Transient overexpression lysate of chromosome 19 open reading frame 62 (C19orf62), transcript variant 2 |
CNY 3080.00 |
|
| LY422382 | Transient overexpression lysate of chromosome 19 open reading frame 62 (C19orf62), transcript variant 1 |
CNY 3080.00 |
|
| PH302644 | C19orf62 MS Standard C13 and N15-labeled recombinant protein (NP_054892) |
CNY 19520.00 |
|
| PH310626 | C19orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028721) |
CNY 19520.00 |
|
| TP310626 | Recombinant protein of human chromosome 19 open reading frame 62 (C19orf62), transcript variant 1, 20 µg |
CNY 2900.00 |
其它HSPC142产品
