COMMD10 (NM_016144) Human Recombinant Protein
CAT#: TP302655
Recombinant protein of human COMM domain containing 10 (COMMD10), 20 µg
View other "COMMD10" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202655 protein sequence
Red=Cloning site Green=Tags(s) MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHL VLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQ LNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057228 |
Locus ID | 51397 |
UniProt ID | Q9Y6G5 |
Refseq Size | 1456 |
Cytogenetics | 5q23.1 |
Refseq ORF | 606 |
Synonyms | PTD002 |
Summary | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF-kappa-B (PubMed:15799966).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414157 | COMMD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414157 | Transient overexpression lysate of COMM domain containing 10 (COMMD10) |
CNY 3080.00 |
|
PH302655 | COMMD10 MS Standard C13 and N15-labeled recombinant protein (NP_057228) |
CNY 19520.00 |
其它COMMD10产品