FABP4 (NM_001442) Human Recombinant Protein
CAT#: TP302702
Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4), 20 µg
View other "FABP4" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202702 representing NM_001442
Red=Cloning site Green=Tags(s) MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQE FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 14.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001433 |
| Locus ID | 2167 |
| UniProt ID | P15090 |
| Refseq Size | 619 |
| Cytogenetics | 8q21.13 |
| Refseq ORF | 396 |
| Synonyms | A-FABP; AFABP; ALBP; aP2; HEL-S-104 |
| Summary | FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | PPAR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400558 | FABP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400558 | Transient overexpression lysate of fatty acid binding protein 4, adipocyte (FABP4) |
CNY 3080.00 |
|
| PH302702 | FABP4 MS Standard C13 and N15-labeled recombinant protein (NP_001433) |
CNY 19520.00 |
|
| TP720117 | Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4) |
CNY 3140.00 |

