CD69 (NM_001781) Human Recombinant Protein
CAT#: TP302756L
Recombinant protein of human CD69 molecule (CD69), transcript variant 1, 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202756 protein sequence
Red=Cloning site Green=Tags(s) MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPG QYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREE HWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001772 |
| Locus ID | 969 |
| UniProt ID | Q07108 |
| Refseq Size | 1676 |
| Cytogenetics | 12p13.31 |
| Refseq ORF | 597 |
| Synonyms | AIM; BL-AC/P26; CLEC2C; EA1; GP32/28; MLR-3 |
| Summary | This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
| FAQs |
| SDS |
