ARHI (DIRAS3) (NM_004675) Human Recombinant Protein
CAT#: TP302787
Recombinant protein of human DIRAS family, GTP-binding RAS-like 3 (DIRAS3), 20 µg
View other "ARHI" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202787 protein sequence
Red=Cloning site Green=Tags(s) MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE KKSQMPNTTEKLLDKCIIM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vitro kinase assay substrate (negative control) (PMID: 26146988) |
Reference Data | |
RefSeq | NP_004666 |
Locus ID | 9077 |
UniProt ID | O95661 |
Refseq Size | 1642 |
Cytogenetics | 1p31.3 |
Refseq ORF | 687 |
Synonyms | ARHI; NOEY2 |
Summary | This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
CDK5 Regulates Paclitaxel Sensitivity in Ovarian Cancer Cells by Modulating AKT Activation, p21Cip1- and p27Kip1-Mediated G1 Cell Cycle Arrest and Apoptosis
,Zhang, S;Lu, Z;Mao, W;Ahmed, AA;Yang, H;Zhou, J;Jennings, N;Rodriguez-Aguayo, C;Lopez-Berestein, G;Miranda, R;Qiao, W;Baladandayuthapani, V;Li, Z;Sood, AK;Liu, J;Le, XF;Bast, RC;,
PLoS ONE
,PubMed ID 26146988
[DIRAS3]
|
DIRAS3 regulates the autophagosome initiation complex in dormant ovarian cancer cells
,null,
Autophagy
,PubMed ID 24879154
[DIRAS3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401484 | DIRAS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401484 | Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 3 (DIRAS3) |
CNY 3080.00 |
|
PH302787 | DIRAS3 MS Standard C13 and N15-labeled recombinant protein (NP_004666) |
CNY 19520.00 |