PSMC6 (NM_002806) Human Recombinant Protein
CAT#: TP302809
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), 20 µg
View other "PSMC6" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 6281.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202809 protein sequence
Red=Cloning site Green=Tags(s) MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFI VKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSE QIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGE SARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATN RPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEA GMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002797 |
| Locus ID | 5706 |
| UniProt ID | P62333 |
| Refseq Size | 1599 |
| Cytogenetics | 14q22.1 |
| Refseq ORF | 1167 |
| Synonyms | p42; RPT5; SUG2 |
| Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Proteasome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400994 | PSMC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432217 | PSMC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400994 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) |
CNY 3080.00 |
|
| LY432217 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) |
CNY 3080.00 |
|
| PH302809 | PSMC6 MS Standard C13 and N15-labeled recombinant protein (NP_002797) |
CNY 19520.00 |
|
| TP761520 | Purified recombinant protein of Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
