ING4 (NM_016162) Human Recombinant Protein
CAT＃: TP302827
Recombinant protein of human inhibitor of growth family, member 4 (ING4), transcript variant 1, 20 µg
View other "ING4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202827 protein sequence
Red=Cloning site Green=Tags(s) MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057246 |
| Locus ID | 51147 |
| UniProt ID | Q9UNL4 |
| Refseq Size | 1458 |
| Cytogenetics | 12p13.31 |
| Refseq ORF | 747 |
| Synonyms | my036; p29ING4 |
| Summary | This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402512 | ING4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426813 | ING4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402512 | Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 1 |
CNY 3080.00 |
|
| LY426813 | Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 6 |
CNY 3080.00 |
|
| PH302827 | ING4 MS Standard C13 and N15-labeled recombinant protein (NP_057246) |
CNY 19520.00 |
|
| PH325191 | ING4 MS Standard C13 and N15-labeled recombinant protein (NP_001121058) |
CNY 14250.00 |
|
| TP325191 | Purified recombinant protein of Homo sapiens inhibitor of growth family, member 4 (ING4), transcript variant 6, 20 µg |
CNY 2900.00 |
Rabbit anti-ING4 Polyclonal Antibody
热销推荐
