TSSC3 (PHLDA2) (NM_003311) Human Recombinant Protein
CAT#: TP302884
Recombinant protein of human pleckstrin homology-like domain, family A, member 2 (PHLDA2), 20 µg
View other "TSSC3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202884 protein sequence
Red=Cloning site Green=Tags(s) MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYF TIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEP SRPSPQPKPRTP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003302 |
Locus ID | 7262 |
UniProt ID | Q53GA4 |
Refseq Size | 937 |
Cytogenetics | 11p15.4 |
Refseq ORF | 456 |
Synonyms | BRW1C; BWR1C; HLDA2; IPL; TSSC3 |
Summary | This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver. [provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418773 | PHLDA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418773 | Transient overexpression lysate of pleckstrin homology-like domain, family A, member 2 (PHLDA2) |
CNY 3080.00 |
|
PH302884 | PHLDA2 MS Standard C13 and N15-labeled recombinant protein (NP_003302) |
CNY 19520.00 |
|
TP720902 | Purified recombinant protein of Human pleckstrin homology-like domain, family A, member 2 (PHLDA2) |
CNY 1800.00 |