Nuclear Factor Erythroid Derived 2 (NFE2) (NM_006163) Human Recombinant Protein
CAT#: TP302924
Recombinant protein of human nuclear factor (erythroid-derived 2), 45kDa (NFE2), 20 µg
View other "Nuclear Factor Erythroid Derived 2" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202924 protein sequence
Red=Cloning site Green=Tags(s) MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSI HPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQE DPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAETPLALEPSSG PVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAA QNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEY ALQQAADGTIFLVPRGTKMEATD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006154 |
| Locus ID | 4778 |
| UniProt ID | Q16621 |
| Refseq Size | 1697 |
| Cytogenetics | 12q13.13 |
| Refseq ORF | 1119 |
| Synonyms | NF-E2; p45 |
| Summary | Component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. Binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. Requires MAFK or other small MAF proteins for binding to the NF-E2 motif. May play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401856 | NFE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427772 | NFE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401856 | Transient overexpression lysate of nuclear factor (erythroid-derived 2), 45kDa (NFE2), transcript variant 1 |
CNY 3080.00 |
|
| LY427772 | Transient overexpression lysate of nuclear factor (erythroid-derived 2), 45kDa (NFE2), transcript variant 2 |
CNY 3080.00 |
|
| PH302924 | NFE2 MS Standard C13 and N15-labeled recombinant protein (NP_006154) |
CNY 19520.00 |
|
| TP761189 | Purified recombinant protein of Human nuclear factor (erythroid-derived 2), 45kDa (NFE2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Nuclear Factor Erythroid Derived 2产品
