ROR alpha (RORA) (NM_134261) Human Recombinant Protein
CAT#: TP302926
Recombinant protein of human RAR-related orphan receptor A (RORA), transcript variant 1, 20 µg
View other "ROR alpha" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202926 representing NM_134261
Red=Cloning site Green=Tags(s) MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSR DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPE GSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMA FKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 58.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_599023 |
| Locus ID | 6095 |
| UniProt ID | P35398 |
| Refseq Size | 1847 |
| Cytogenetics | 15q22.2 |
| Refseq ORF | 1569 |
| Synonyms | IDDECA; NR1F1; ROR1; ROR2; ROR3; RZR-ALPHA; RZRA |
| Summary | The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The CH25H-CYP7B1-RORα axis of cholesterol metabolism regulates osteoarthritis
,Choi, WS;Lee, G;Song, WH;Koh, JT;Yang, J;Kwak, JS;Kim, HE;Kim, SK;Son, YO;Nam, H;Jin, I;Park, ZY;Kim, J;Park, IY;Hong, JI;Kim, HA;Chun, CH;Ryu, JH;Chun, JS;,
Nature
,PubMed ID 30728500
[ROR alpha]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401041 | RORA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC403350 | RORA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408623 | RORA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401041 | Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 3 |
CNY 4840.00 |
|
| LY403350 | Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 1 |
CNY 3080.00 |
|
| LY408623 | Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 4 |
CNY 4840.00 |
|
| PH302926 | RORA MS Standard C13 and N15-labeled recombinant protein (NP_599023) |
CNY 19520.00 |
其它ROR alpha产品


