DERL2 (NM_016041) Human Recombinant Protein
CAT#: TP303046
Recombinant protein of human Der1-like domain family, member 2 (DERL2), 20 µg
View other "DERL2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203046 protein sequence
Red=Cloning site Green=Tags(s) MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFN FLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVR MNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIFD TPDEDPNYNPLPEERPGGFAWGEGQRLGG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057125 |
Locus ID | 51009 |
UniProt ID | Q9GZP9 |
Refseq Size | 1156 |
Cytogenetics | 17p13.2 |
Refseq ORF | 717 |
Synonyms | CGI-101; derlin-2; DERtrin-2; F-LAN-1; F-LANa; FLANa |
Summary | Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL2 is involved in the degradation of misfolded glycoproteins in the ER (Oda et al., 2006 [PubMed 16449189]).[supplied by OMIM, Mar 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402491 | DERL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402491 | Transient overexpression lysate of Der1-like domain family, member 2 (DERL2) |
CNY 3080.00 |
|
PH303046 | DERL2 MS Standard C13 and N15-labeled recombinant protein (NP_057125) |
CNY 19520.00 |