TNNI1 (NM_003281) Human Recombinant Protein
CAT#: TP303127
Purified recombinant protein of Homo sapiens troponin I type 1 (skeletal, slow) (TNNI1), 20 µg
View other "TNNI1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203127 protein sequence
Red=Cloning site Green=Tags(s) MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLSALQDLCRELH AKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSADAMLRALLGSKHKVSMDLRA NLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDAAKSPTSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003272 |
| Locus ID | 7135 |
| UniProt ID | P19237 |
| Refseq Size | 6162 |
| Cytogenetics | 1q32.1 |
| Refseq ORF | 561 |
| Synonyms | SSTNI; TNN1 |
| Summary | Troponin proteins associate with tropomyosin and regulate the calcium sensitivity of the myofibril contractile apparatus of striated muscles. Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. The TnI-fast and TnI-slow genes are expressed in fast-twitch and slow-twitch skeletal muscle fibers, respectively, while the TnI-cardiac gene is expressed exclusively in cardiac muscle tissue. This gene encodes the Troponin-I-skeletal-slow-twitch protein. This gene is expressed in cardiac and skeletal muscle during early development but is restricted to slow-twitch skeletal muscle fibers in adults. The encoded protein prevents muscle contraction by inhibiting calcium-mediated conformational changes in actin-myosin complexes. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401132 | TNNI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401132 | Transient overexpression lysate of troponin I type 1 (skeletal, slow) (TNNI1) |
CNY 3080.00 |
|
| PH303127 | TNNI1 MS Standard C13 and N15-labeled recombinant protein (NP_003272) |
CNY 14250.00 |
|
| TP710222 | Purified recombinant protein of Human troponin I type 1 (skeletal, slow) (TNNI1), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
|
| TP761473 | Purified recombinant protein of Human MIS18 kinetochoHuman troponin I type 1 (skeletal, slow) (TNNI1), full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2040.00 |
