GCDFP 15 (PIP) (NM_002652) Human Recombinant Protein
CAT#: TP303135
Recombinant protein of human prolactin-induced protein (PIP), 20 µg
View other "GCDFP 15" proteins (6)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC203135 protein sequence Red=Cloning site Green=Tags(s) MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI EILKVE myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 16.4 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Bioactivity | Cell treatment (PMID: 27837018) | 
| Reference Data | |
| RefSeq | NP_002643 | 
| Locus ID | 5304 | 
| UniProt ID | P12273 | 
| Refseq Size | 591 | 
| Cytogenetics | 7q34 | 
| Refseq ORF | 438 | 
| Synonyms | GCDFP-15; GCDFP15; GPIP4 | 
| Protein Families | Secreted Protein | 
Citations (2)
| The use of this Proteins has been cited in the following citations: | 
|---|
| Bone Microenvironment Changes in Latexin Expression Promote Chemoresistance
                                                ,null,
                                                Molecular cancer research : MCR
                                                ,PubMed ID 28087740
                                                [PIP] | 
| Role of dendritic cell maturation factors produced by human invariant NKT cells in immune tolerance
                                                ,Lee, HW;Jie, HB;Bollyky, PL;Sarracino, D;Kim, TS;Wilson, BS;,
                                                J. Leukoc. Biol.
                                                ,PubMed ID 27837018
                                                [PIP] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419186 | PIP HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY419186 | Transient overexpression lysate of prolactin-induced protein (PIP) | CNY 3080.00 | |
| PH303135 | PIP MS Standard C13 and N15-labeled recombinant protein (NP_002643) | CNY 19520.00 | |
| TP701042 | Purified recombinant protein of Human prolactin-induced protein (PIP), Gln29-End, with C-terminal His tag, expressed in HEK293 cells, 50ug | CNY 7820.00 | |
| TP710252 | Purified recombinant protein of Human prolactin-induced protein (PIP), residues aa29–end, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug | CNY 4020.00 | |
| TP762416 | Purified recombinant protein of Human prolactin-induced protein (PIP), Gln29-End, with N-terminal His tag, expressed in E.coli, 50ug | CNY 1950.00 | 
其它GCDFP 15产品


 
                        

 
        