SERPINB2 (NM_002575) Human Recombinant Protein
CAT#: TP303139
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2, 20 µg
View other "SERPINB2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203139 protein sequence
Red=Cloning site Green=Tags(s) MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE YIRLCQKYYSSEPQAVDFLECAEEARKKIYSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vivo treatment (intracerebral) (PMID: 30093305) |
Reference Data | |
RefSeq | NP_002566 |
Locus ID | 5055 |
UniProt ID | P05120 |
Refseq Size | 1922 |
Cytogenetics | 18q21.33-q22.1 |
Refseq ORF | 1245 |
Synonyms | HsT1201; PAI; PAI-2; PAI2; PLANH2 |
Summary | Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Post-injury nose-to-brain delivery of Activin A and SerpinB2 reduces brain damage in a mouse stroke model
,Buchthal, B;Weiss, U;Bading, H;,
Molecular Therapy
,PubMed ID 30093305
[SERPINB2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400915 | SERPINB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428363 | SERPINB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400915 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2 |
CNY 3080.00 |
|
LY428363 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 1 |
CNY 3080.00 |
|
PH303139 | SERPINB2 MS Standard C13 and N15-labeled recombinant protein (NP_002566) |
CNY 19520.00 |
|
PH327583 | SERPINB2 MS Standard C13 and N15-labeled recombinant protein (NP_001137290) |
CNY 19520.00 |
|
TP327583 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它SERPINB2产品