GAP43 (NM_002045) Human Recombinant Protein
CAT#: TP303175
Recombinant protein of human growth associated protein 43 (GAP43), transcript variant 2, 20 µg
View other "GAP43" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203175 protein sequence
Red=Cloning site Green=Tags(s) MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKD EAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET ESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIE AVDETKPKESARQDEGKEEEPEADQEHA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002036 |
| Locus ID | 2596 |
| UniProt ID | P17677 |
| Refseq Size | 1747 |
| Cytogenetics | 3q13.31 |
| Refseq ORF | 714 |
| Synonyms | B-50; GAP-43; PP46 |
| Summary | The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Kinesin-1 Proteins KIF5A, -5B, and -5C Promote Anterograde Transport of Herpes Simplex Virus Enveloped Virions in Axons
,null,
Journal of Virology
,PubMed ID 30068641
[GAP43]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400750 | GAP43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400750 | Transient overexpression lysate of growth associated protein 43 (GAP43), transcript variant 2 |
CNY 3080.00 |
|
| PH303175 | GAP43 MS Standard C13 and N15-labeled recombinant protein (NP_002036) |
CNY 19520.00 |
