B3GAT3 (NM_012200) Human Recombinant Protein
CAT#: TP303223
Recombinant protein of human beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I) (B3GAT3), 20 µg
View other "B3GAT3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203223 representing NM_012200
Red=Cloning site Green=Tags(s) MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPE PEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPLVSGLLAASGLLFTHLVVLTP KAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFEEMRWT RGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHL ESSLLSHLVDPKDLEPRAANCTRVLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036332 |
Locus ID | 26229 |
UniProt ID | O94766 |
Refseq Size | 1456 |
Cytogenetics | 11q12.3 |
Refseq ORF | 1005 |
Synonyms | GLCATI; glcUAT-I; JDSCD |
Summary | The protein encoded by this gene is a member of the glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product catalyzes the formation of the glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction in the final step of the biosynthesis of the linkage region of proteoglycans. A pseudogene of this gene has been identified on chromosome 3. [provided by RefSeq, Dec 2013] |
Protein Families | Transmembrane |
Protein Pathways | Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402164 | B3GAT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402164 | Transient overexpression lysate of beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I) (B3GAT3) |
CNY 3080.00 |
|
PH303223 | B3GAT3 MS Standard C13 and N15-labeled recombinant protein (NP_036332) |
CNY 19520.00 |