MAGP2 (MFAP5) (NM_003480) Human Recombinant Protein
CAT#: TP303242
Recombinant protein of human microfibrillar associated protein 5 (MFAP5), 20 µg
View other "MAGP2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203242 protein sequence
Red=Cloning site Green=Tags(s) MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003471 |
| Locus ID | 8076 |
| UniProt ID | Q13361 |
| Refseq Size | 2949 |
| Cytogenetics | 12p13.31 |
| Refseq ORF | 519 |
| Synonyms | AAT9; MAGP-2; MAGP2; MFAP-5; MP25 |
| Summary | This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401177 | MFAP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401177 | Transient overexpression lysate of microfibrillar associated protein 5 (MFAP5) |
CNY 3080.00 |
|
| PH303242 | MFAP5 MS Standard C13 and N15-labeled recombinant protein (NP_003471) |
CNY 19520.00 |
