C6orf48 (NM_001040438) Human Recombinant Protein
CAT#: TP303286
Recombinant protein of human chromosome 6 open reading frame 48 (C6orf48), transcript variant 2, 20 µg
View other "C6orf48" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203286 protein sequence
Red=Cloning site Green=Tags(s) MERSFVWLSCLDSDSCNLTFRLGEVESHACSPSLLWNLLTQYLPPGAGHILRTYNFPVLSCVSSCHLIGG KMPEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035528 |
Locus ID | 50854 |
Refseq Size | 751 |
Cytogenetics | 6p21.33 |
Refseq ORF | 225 |
Synonyms | D6S57; G8 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421755 | C6orf48 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421756 | C6orf48 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421755 | Transient overexpression lysate of chromosome 6 open reading frame 48 (C6orf48), transcript variant 1 |
CNY 3080.00 |
|
LY421756 | Transient overexpression lysate of chromosome 6 open reading frame 48 (C6orf48), transcript variant 2 |
CNY 3080.00 |
|
PH303286 | C6orf48 MS Standard C13 and N15-labeled recombinant protein (NP_001035528) |
CNY 19520.00 |
其它C6orf48产品