CISD1 (NM_018464) Human Recombinant Protein
CAT#: TP303308
Recombinant protein of human CDGSH iron sulfur domain 1 (CISD1), 20 µg
View other "CISD1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203308 protein sequence
Red=Cloning site Green=Tags(s) MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060934 |
Locus ID | 55847 |
UniProt ID | Q9NZ45 |
Refseq Size | 2115 |
Cytogenetics | 10q21.1 |
Refseq ORF | 324 |
Synonyms | C10orf70; MDS029; mitoNEET; ZCD1 |
Summary | This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. [provided by RefSeq, Feb 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413042 | CISD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413042 | Transient overexpression lysate of CDGSH iron sulfur domain 1 (CISD1) |
CNY 3080.00 |
|
PH303308 | CISD1 MS Standard C13 and N15-labeled recombinant protein (NP_060934) |
CNY 19520.00 |