LASS4 (CERS4) (NM_024552) Human Recombinant Protein
CAT#: TP303402
Recombinant protein of human LAG1 homolog, ceramide synthase 4 (LASS4), 20 µg
View other "LASS4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203402 protein sequence
Red=Cloning site Green=Tags(s) MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGV RDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRF LFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQV IHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLF PTQILYTTYYESISNRGPFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSS EEVAAAQEPLQLKNGAAGGPRPAPTDGPQSRVAGRLTNRHTTAT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078828 |
Locus ID | 79603 |
UniProt ID | Q9HA82 |
Refseq Size | 1817 |
Cytogenetics | 19p13.2 |
Refseq ORF | 1182 |
Synonyms | LASS4; Trh1 |
Summary | May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing different fatty acid donors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411226 | CERS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411226 | Transient overexpression lysate of LAG1 homolog, ceramide synthase 4 (LASS4) |
CNY 3080.00 |
|
PH303402 | LASS4 MS Standard C13 and N15-labeled recombinant protein (NP_078828) |
CNY 19520.00 |