DPP3 (NM_130443) Human Recombinant Protein
CAT#: TP303406
Recombinant protein of human dipeptidyl-peptidase 3 (DPP3), transcript variant 2, 20 µg
View other "DPP3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203406 protein sequence
Red=Cloning site Green=Tags(s) MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQ DPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEV RGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKP YYEVRLASVLGSEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQ YIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASA EQLLKELPWPPTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQ REKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYR SGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPE AFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKS TGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSF SERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 82.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_569710 |
| Locus ID | 10072 |
| UniProt ID | Q9NY33 |
| Refseq Size | 3101 |
| Cytogenetics | 11q13.2 |
| Refseq ORF | 2211 |
| Synonyms | DPPIII |
| Summary | This gene encodes a protein that is a member of the M49 family of metallopeptidases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2012] |
| Protein Families | Druggable Genome, Protease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408959 | DPP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417120 | DPP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408959 | Transient overexpression lysate of dipeptidyl-peptidase 3 (DPP3), transcript variant 2 |
CNY 3080.00 |
|
| LY417120 | Transient overexpression lysate of dipeptidyl-peptidase 3 (DPP3), transcript variant 1 |
CNY 3080.00 |
|
| PH303406 | DPP3 MS Standard C13 and N15-labeled recombinant protein (NP_569710) |
CNY 19520.00 |
|
| PH319658 | DPP3 MS Standard C13 and N15-labeled recombinant protein (NP_005691) |
CNY 19520.00 |
|
| TP319658 | Recombinant protein of human dipeptidyl-peptidase 3 (DPP3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP721179 | Purified recombinant protein of Human dipeptidyl-peptidase 3 (DPP3), transcript variant 2 |
CNY 1800.00 |
